PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA04g20770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family ZF-HD
Protein Properties Length: 263aa    MW: 28975.5 Da    PI: 9.3092
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA04g20770genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.43.1e-323993358
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                 ++rY+eClkNhAa++Gg+++DGCgEfmps geegt +alkCaAC+CHRnFHR+e++
   CA04g20770 39 AARYRECLKNHAANIGGNVTDGCGEFMPS-GEEGTLEALKCAACNCHRNFHRKEQN 93
                 689*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.2E-294092IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-304191IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-224191IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.7154291IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.51E-16189249IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-29190252IPR009057Homeodomain-like
TIGRFAMsTIGR015655.1E-28191248IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MSLAGEEKEM RMPGTGVAPY NSAGGITGSN KFNKVSSRAA RYRECLKNHA ANIGGNVTDG  60
CGEFMPSGEE GTLEALKCAA CNCHRNFHRK EQNIGGGDNN NNAGIMVVHP LQLPQPLPSP  120
IPSLNHHHHH QHGGRSIWTT MPPQPVKMAF GGSGGSGATD SSSEELNFNT YHHQQATSVP  180
PQPQPPFVLA KKRFRTKFSQ EQKDKMLEFA EKLGWRIPRE DDTEVQRFCS QVGVKRQVFK  240
VWMHNNKNPS AKKNTLQEDQ QP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-241922491875ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4578111e-91CU457811.8 S.lycopersicum DNA sequence from clone LE_HBa-132M8 on chromosome 4, complete sequence.
GenBankCU4682391e-91CU468239.4 S.lycopersicum DNA sequence from clone SL_MboI-124K5 on chromosome 4, complete sequence.
GenBankHG9755161e-91HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016568547.10.0PREDICTED: zinc-finger homeodomain protein 6
SwissprotQ9ZPW73e-61ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLM0ZWJ41e-127M0ZWJ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000095811e-127(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.16e-52homeobox protein 24